PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00010.455
Common NameAMTR_s00010p00261620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family ZF-HD
Protein Properties Length: 95aa    MW: 10456.6 Da    PI: 8.3354
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00010.455genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.41.3e-312680358
                               ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                                               vrY eC+kNhAa++Gg+a+DGC+Efm+s geegt++alkCaACgCHRnFH+re+e
  evm_27.model.AmTr_v1.0_scaffold00010.455 26 CVRYAECQKNHAANIGGYALDGCREFMAS-GEEGTSEALKCAACGCHRNFHKREEE 80
                                              689*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-232791IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.4E-302779IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.3E-272878IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.2762978IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MRRQESSSRR NETHVRSSGQ CTRRKCVRYA ECQKNHAANI GGYALDGCRE FMASGEEGTS  60
EALKCAACGC HRNFHKREEE GVGICECPPS STTR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032530.17e-33Mini zinc finger 2 isoform 1
RefseqXP_007032531.18e-33Mini zinc finger 2 isoform 2, partial
SwissprotQ9CA519e-31MIF1_ARATH; Mini zinc finger protein 1
TrEMBLW1NGZ34e-63W1NGZ3_AMBTC; Uncharacterized protein
STRINGPOPTR_0004s12510.16e-32(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.15e-32mini zinc finger 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]